SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479173254|ref|YP_007801441.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479173254|ref|YP_007801441.1|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-76
Family ETFP subunits 0.0000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479173254|ref|YP_007801441.1|
Sequence length 264
Comment Electron transfer flavoprotein, beta subunit [Faecalibacterium prausnitzii SL3/3]
Sequence
MKAIVCVKQVPDTSGKVSVKPDGTLDRASMATITNPDDLNALEAALKLKDATGCEVVVVT
MGPPPAEGMLRELLARGADKAVLVSGREFGGSDTFATSQILAAAVNKIGVGPEDVVFCGR
QAIDGDTAQVGPQIAEKLHLPQVTYVADIQKDGNTLTVKRMLEDGYMMVKVQTPCLLTCI
KELNDPRYMSVNGIFTCYDKPMEVFDYNALKDDPLIEVDTIGLKGSPTNVFKSFTPPQKG
AGTMLQGDDVAAQLAGILAKKHLI
Download sequence
Identical sequences A0A2A7A592 A8SFN7 D4K639
WP_005926210.1.86991 gi|479173254|ref|YP_007801441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]