SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479173255|ref|YP_007801442.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479173255|ref|YP_007801442.1|
Domain Number 1 Region: 8-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.58e-52
Family ETFP subunits 0.0082
Further Details:      
 
Domain Number 2 Region: 234-357
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.69e-41
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.0000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479173255|ref|YP_007801442.1|
Sequence length 364
Comment Electron transfer flavoprotein, alpha subunit [Faecalibacterium prausnitzii SL3/3]
Sequence
MADFNEYKGVWVFCEQRQGALMSTDFELVSEARKLADELGCEVTGLLLGDNVEGIAKELG
GYGADKVLVCDSPLLKDYTTDAYAKVVCDMVNEYKPEVLLIGATNIGRDLGPRCAARLHT
GLTADATHLDIDTAKYIDFLKESSTIDLSKQKFDMEDRNLKMTRPAFGGHLMATIICPRF
RPQMSTVRPGVMKKAPFDQAKADACQIVKPAFSLTAEDIKTEVLSVEKAAEKLVDLIGAD
VIVSVGRGISKDVNKGIELAEQLAAALGGGVVGASRAVTDAGWMTADHQVGQTGKTVHPK
IYVALGISGAIQHTAGMQDSECIIAVNKNEGAPIFGVADYGIVGDLFKVVPELIKQIEAA
KAAL
Download sequence
Identical sequences A0A173R2U1 A8SFN6 D4K640
gi|479173255|ref|YP_007801442.1| WP_005926207.1.34810 WP_005926207.1.86991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]