SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479173375|ref|YP_007801562.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479173375|ref|YP_007801562.1|
Domain Number 1 Region: 5-198
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.52e-55
Family Class I glutamine amidotransferases (GAT) 0.0000107
Further Details:      
 
Domain Number 2 Region: 181-438
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.98e-55
Family N-type ATP pyrophosphatases 0.00000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479173375|ref|YP_007801562.1|
Sequence length 516
Comment GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit [Faecalibacterium prausnitzii SL3/3]
Sequence
MQHETVIVLDFGGQYNQLIARRVRENNVYCEIYSYKTDLSVIKAKNPKGIIFTGGPNSVY
LEDSPTIDPEIFSWGVPVLGICYGSQLMMHLLGGHVCRAPEREYGKTEVFVNTESKLFTD
VQPSTICWMSHNDYIEQAAPGFQITAHTANCPVAAVENAEKGLYAVQFHPEVLHTAEGKK
MLRNFVYNVCGCSGDWKMDSFVENNVKALRERIGEGKVLCALSGGVDSSVLAAMLAKAIG
KQLTCVFVDHGLLRKNEKEEVCSVFGPGNANGFDINFICVDARDRYFSKLKGITEPERKR
KIIGEEFIRVFEEEAKKIGKVDFLAQGTIYPDVVESGLGGESTVIKSHHNVGGLPDTVDF
KELVEPLRNLFKDEVRQAGRELGLPEYLVSRQPFPGPGLGIRIIGEVTPEKVAIVQDADA
IWREEIAKAGLDKEISQYYAALTNMHSVGVMGDERTYDYAVALRAVTTTDFMTAESYDMP
WDVLGTVTSRIVNEVKHVNRVFYDCTGKPPATIELE
Download sequence
Identical sequences A0A2A7A5W3 D4K6G0
gi|479173375|ref|YP_007801562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]