SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330470187|ref|YP_004407930.1| from Verrucosispora maris AB-18-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330470187|ref|YP_004407930.1|
Domain Number 1 Region: 61-163
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 8.5e-34
Family N-utilization substance G protein NusG, N-terminal domain 0.0000591
Further Details:      
 
Domain Number 2 Region: 185-240
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.1e-16
Family N-utilization substance G protein NusG, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330470187|ref|YP_004407930.1|
Sequence length 240
Comment nusg antitermination factor [Verrucosispora maris AB-18-032]
Sequence
MPEYDETAETPDEQSTVATAAGDESVEAASEPEFAMTEPAPDEDYDPVAELRQKLRYAPG
DWYVVHSYAGYENKVKTNLETRITSLDMEDYIYQVEVPTREEVEVKNGKRSQVQAKVFPG
YILVRMELTAESYSCVRNTPGVTGFVGATDRADRPAPLSLDEVLKWLAPAVETEQKKAKP
EIKVLDFEVGDSVTVTDGAFASLPATISEINADQQKLKVLVSIFGRETPVELNFNQVAKI
Download sequence
Identical sequences F4FDB9
gi|330470187|ref|YP_004407930.1| WP_013735967.1.26845 WP_013735967.1.63642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]