SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307720217|ref|YP_003891357.1| from Sulfurimonas autotrophica DSM 16294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307720217|ref|YP_003891357.1|
Domain Number 1 Region: 13-63,160-180
Classification Level Classification E-value
Superfamily TPR-like 0.00000664
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Weak hits

Sequence:  gi|307720217|ref|YP_003891357.1|
Domain Number - Region: 91-174
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0419
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307720217|ref|YP_003891357.1|
Sequence length 197
Comment hypothetical protein Saut_0296 [Sulfurimonas autotrophica DSM 16294]
Sequence
MGTISKYKILSQAKESFSKEEYKSALEKFAQVLQNYPNSKEAFNGVILSEMAMSGEEGAE
ALFDYYEILREEDKEEADSIMSEILEGMDGSLEKLSEVFAEPLRNRLEFEEGILYSDFQK
ILQEGGDFVETFENIMFSTRVIITSKEDFLDFLDKLIEHDFAQMALTYLENALSVYPDDK
LLRKLLKKLAQGKSIEN
Download sequence
Identical sequences E0UU36
gi|307720217|ref|YP_003891357.1| WP_013326101.1.28870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]