SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307720760|ref|YP_003891900.1| from Sulfurimonas autotrophica DSM 16294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307720760|ref|YP_003891900.1|
Domain Number 1 Region: 109-533
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.75e-63
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000012
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily Cytochrome c 1.02e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307720760|ref|YP_003891900.1|
Sequence length 545
Comment nitrite reductase [Sulfurimonas autotrophica DSM 16294]
Sequence
MRLNKLVTSVAALAVVSSGLFAGTSHMNVAKMFEKECQGCHGPNHEGGVGADLRPNKIAK
KNAYTLSEVILNGRPGTAMPPFNEKMNQADAQKMVDYLQHFKGKKMSVLSMEAVKAGWKK
LNDRTALLKKYPHAVDVKKVTDICFVTERDAARVVFIDGTSGKVLSKHPAGFAVHVTVTN
KRQPRYAYSISRSGLVTMFDLASKGQQKIAQVQVGSDSRGLAVSPDGKYLMAGNYVPGGA
ILMDAMTLEPLKVYPTSSVINMDGDIGSSRVAGIYDTPYGPYIAFALKDAGHVYIVDYSK
PNFPIVGDIPNIGKILHDGFENEGKEIGRYLMQASQGSDVMGVVDFKTKSLVAKVYTGPG
SKPHPGQGSSWYNDRYGQLYATNSMNVGDVVIWDSNWDVVAHVRTAGGGLFVGTSEHTPF
IWSDNVLGGPDNWNKIHLINKQTLEVDRILTVGTKQGTITDPVTHKLLYKWKVPTVKNKK
GKVVVPRILHAEPANHGHWTMVSEWNAGRIGIYEAKTGKFVKYIKGLTTPTFTYSIEHRQ
SIPGA
Download sequence
Identical sequences E0UR78
WP_013326644.1.28870 gi|307720760|ref|YP_003891900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]