SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307721537|ref|YP_003892677.1| from Sulfurimonas autotrophica DSM 16294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307721537|ref|YP_003892677.1|
Domain Number 1 Region: 37-144
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000552
Family DBL homology domain (DH-domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307721537|ref|YP_003892677.1|
Sequence length 152
Comment hypothetical protein Saut_1618 [Sulfurimonas autotrophica DSM 16294]
Sequence
MDIKDLNELRNEFEMMQQQAMQAACEDGSCVEDEYEDYPDYLKAIYAEIMPPAKSGIYFS
RWDLKRMAAELDESFAIDVRERMFKNFMQWIATPEDMLSVVDQFKSHMDMKCELYKEYSQ
KYPAMQELFEPKIQKAQKAKKYLDKVYVEFFT
Download sequence
Identical sequences E0UPD5
gi|307721537|ref|YP_003892677.1| WP_013327418.1.28870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]