SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313665196|ref|YP_004047067.1| from Mycoplasma leachii PG50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313665196|ref|YP_004047067.1|
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.00000000068
Family Thiamin pyrophosphokinase, catalytic domain 0.014
Further Details:      
 
Domain Number 2 Region: 130-205
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000549
Family Thiamin pyrophosphokinase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313665196|ref|YP_004047067.1|
Sequence length 208
Comment thiamine diphosphokinase [Mycoplasma leachii PG50]
Sequence
MNYKTILIVTAKTNLNLEPFNNNSTYVIGVERGCLDLISRNMKIDYAIGDFDKVTDQELE
LIKSKIKNAEIWSPEKDYFDGELAILKGLEASKDAKIIFIANPTKRYDKNYSIFHFIFKY
NLTFINDDSILFKFDKGTNILKFEDYQDYTYVSFISKDNTNITIKDLKYECENLSLSAYS
NSCLSNAFLPYKDGIISSNNPIICILTK
Download sequence
Identical sequences E4PTT1
gi|392389020|ref|YP_005907429.1| gi|313665196|ref|YP_004047067.1| WP_013447619.1.23723 WP_013447619.1.53025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]