SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78778182|ref|YP_394497.1| from Sulfurimonas denitrificans DSM 1251

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78778182|ref|YP_394497.1|
Domain Number 1 Region: 34-372
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.79e-31
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78778182|ref|YP_394497.1|
Sequence length 378
Comment nitrite reductase NirF [Sulfurimonas denitrificans DSM 1251]
Sequence
MYISKFLVSIFLVASVAGIVQAKGVNPVLASIKDEEKIFVVERENNSLGVIEQGMTKGHI
EGMHDMNHGVVKFYDNDGYVISRDGYIIKFDPQSEKILKAYKTSDSAIGFTVEENYIAVA
NYAKKSVDILDRDLNPIKSFETDSKNVGIKKYKNYLVFSQMNNDKITVLKDKNEGKGLPD
FEIFKEFENVGVMPFDAMIKNNNFITGFFKSNFFGVVNLDTMEYSKIDILLEDRKPVLKV
PHFGFWSISEGNVFIPAVGNNKVLVYTSDFKFVKNIEVEGLPVFTALSPDQKYMAVTFSG
DKFPVLQIIDTKTLEVIKRFEFDGKVLHVRWSDVRPNLYVSVNDTNKVAVINTKEWYLAR
EMFGINKPSGIFLYKEAK
Download sequence
Identical sequences Q30P19
WP_011373602.1.32152 326298.Suden_1988 gi|78778182|ref|YP_394497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]