SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352683834|ref|YP_004895818.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683834|ref|YP_004895818.1|
Domain Number 1 Region: 155-232
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000000222
Family TonB 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|352683834|ref|YP_004895818.1|
Sequence length 235
Comment hypothetical protein Acin_0436 [Acidaminococcus intestini RyC-MR95]
Sequence
MKRLPLKGPLLLSLVLHLILLFAVGLMAGRRTIQKPRLLIGVKLMEPGRGTEGHDSSAGG
SKEALEHSLSSLTASMLEEGPVKDDASPDKPRKASMASYTGNGSAGGKKAPMESGAGTGS
GTGIGVGSGDGNGDGRGGASGEGNDASRGATLTSYRKIYPQSARRAGETGSVDVGVAVSE
EGSVTSAWVTASSGYERLDQAALDSAYTWHFDPALDAAGRPIAGETVIRVRYELN
Download sequence
Identical sequences C0WC95 G4Q8Y0 R6M855 U2VSZ8
WP_009015546.1.13197 WP_009015546.1.48401 WP_009015546.1.72252 WP_009015546.1.80408 WP_009015546.1.85528 gi|352683834|ref|YP_004895818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]