SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352684194|ref|YP_004896179.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352684194|ref|YP_004896179.1|
Domain Number 1 Region: 160-240
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 4.05e-20
Family TonB 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352684194|ref|YP_004896179.1|
Sequence length 243
Comment hypothetical protein Acin_0807 [Acidaminococcus intestini RyC-MR95]
Sequence
MVLYAKDRSLMASILIHLFCFGIFSVLSYQGLMTHVKGKGPIYMVGLSGGRKGGAPPAAA
PFRTKNLPPLPARSDDMVTEKSTALPSAKILQPSISKDASASFDVSNDRAESGEGSEKGS
GAGTGMEEGTGDGAGEAGGSGSGGPSFDTDAIQPDVSPTLLSGSAPNYPEAMRSRGIEGR
VTVQMVVGKDGAVEAASVIQSSGYGVMDKAALSAAYTYAFAPAYKEGYAVRCYASKTFVF
ALH
Download sequence
Identical sequences G4Q557 R6M8M1
WP_014128314.1.13197 WP_014128314.1.72252 WP_014128314.1.80408 gi|352684194|ref|YP_004896179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]