SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|563706748|ref|YP_008871352.1| from Babela massiliensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|563706748|ref|YP_008871352.1|
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily F-box domain 0.0015
Family F-box domain 0.012
Further Details:      
 
Domain Number - Region: 99-135
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0902
Family Family 1 bi-partite nucleotidyltransferase subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563706748|ref|YP_008871352.1|
Sequence length 242
Comment F-box domain protein [delta proteobacterium BABL1]
Sequence
MNHKITIVFLWLFYLSNNIFSMSDNLVESQVIENRFLISNLSDELLLNIFKLLVNSYIIN
SDNIFSFYQSVKELKNLNLVCQLFNSILNDRDIINIIDQKRVILRNYYNKFEIPIELSNK
VLKEWLSFKDYKNKSVVFQIGSTKIKIWNIGGKTILKYLYRNGPRYKIGHISSNNSPNIL
YSNEIGIAFLLVSVTIYIVNKIKYSKETSQTHQDKLDNELENNKENTNNNDKIYIKYRKV
IS
Download sequence
Identical sequences V6DF94
WP_023791131.1.71942 gi|563706748|ref|YP_008871352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]