SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|563706949|ref|YP_008871553.1| from Babela massiliensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563706949|ref|YP_008871553.1|
Domain Number 1 Region: 967-1090
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000235
Family FCH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|563706949|ref|YP_008871553.1|
Sequence length 1268
Comment hypothetical protein BABL1_571 [delta proteobacterium BABL1]
Sequence
MKNRYSSFKIIYFFLNILFLFNFTFICSQLTKDLSQPEPEVEEVIEFDPDEEREIEVLPI
QPPVIDGKEVKIGLTMNFPVFGDITLYPEKDKNGKEILKANLTTKSIDFGAFGIKIDNFS
VIIDDNKIPGVSADVTLFGKKATLELVELKKESKIVKKPIPGTKYDELELPIDSATFRIK
FINKPIIPLLPFKSIELNHLDLIVKKQKKPALVSNVNIFGYETQMSYASEQKDTVVSFHI
KKIALSDFISEAKGSDFGNASLNDLTLKSRFSSKEVEVATANKELNSFALDFSGFADFSN
LKVAGLSDISLNKLNIKGTYSKDKGLDIESNVNKFNISALGSINQAKLIFYSTDAIKNKI
AEVKKKLADKPTTVLEELERHELKILTLVGREHKPLIMLTGNGIINLPEIGPLSFNLDSN
YASTGFEIKGTIAQDVKYSNFAINQAVLELNTNTGVITIEGDAVIQGFDVLAKLSAASDP
KDPKNKVYKLEAQTKKKEWQPFKEASVPDFIKDIDIKEISSKVSLVRDPIKGLEAQLNLK
GHAEIMGITAQAEVLSIKNAKQAGVLLKALVPENELPQGFNKLPIHNAAFVATTIEYTDP
ETKVTYNPNSLNLTGKVTLSGALEPLGKMIGSQNAQLNVLGAFDPKKPTDNKISIELSKG
IPIKGHVVSIGPVIVDIRTKNASPYFDLQVHLILRPNSKDRTQELDFSGTTSYSALEIAG
NLRMDGMWRDPFGLNGLSIGDMSISLGINPQTFPETLIPSKFDLGGRLGLAPDKIVSLAI
AINFVDSQAAFLGSLEGADGKLRTLSLVDIITLIADRLGANVPQDKIPVLEVEEPHFSFA
LQDTSVGAIKIPQGIKLKGKIQLLSSIAEVDFGVSKSGIMAKGEMTPVNLGPLKITAAKT
AKGEVRKTKYGGPQIDIEFTSARQNFVINALMELDSMFSGSGDMEVSKDGINFNFEVSVG
PNKLFNGLLNGQSIGSLSNPDFKLLIEMEQKFTRYAQEQISKYLKDAENSVRNNINQAVE
EIKKIDNAIEQHKKDMQSAINDIEKAKKDLDAIDSASKEAEIEINKWKKDVDKLKIDIDK
AKAQIAELKKKEHGWNVVGHIGQKAKILVLEDRISKLESSRAIANTALEYIFKKSATGTL
AISKKTAEAALATGRKFLESVRSVDIAVMQLTRDQLINSLGLARDAGIGVLQGTNFVFTG
LLKGFMVDKVKFQSTLGEVKKGQLFDIQLDMHLLGKPQILKTKFDLKDISKSIESLSKEI
INKFVPKF
Download sequence
Identical sequences V6DIT7
WP_023791579.1.71942 gi|563706949|ref|YP_008871553.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]