SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|563707586|ref|YP_008872190.1| from Babela massiliensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|563707586|ref|YP_008872190.1|
Domain Number 1 Region: 52-113,275-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-21
Family Ankyrin repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|563707586|ref|YP_008872190.1|
Domain Number - Region: 177-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0523
Family FCH domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|563707586|ref|YP_008872190.1|
Sequence length 381
Comment Ankyrin repeats containing protein [delta proteobacterium BABL1]
Sequence
MKYKVCLLSFLTVNMFTAIYCMVLDQKADSYLFKNELNLTLFHILDKSPELISKENLKVA
IELIDQGADINLRNREGNTVLLLSVYKGYESIVKILIKNNADLDIKNNLGQTAQEIAVAK
IHNLSDKDQKEIYFNINSLLINAIIIADQKLKKDVDQRAEEKSAIENFDKELIVLFFQES
LRGFVNSYSDIFALYQDSFEKDWQQELMNIRCVCKKFNSVIQEYIKSLESLNKVKKERFE
YLRDMIRSQNKLNQEELNLGLVKILEKLEATSNSSQQISQADLKEAVRLIISGADIKISN
KYGNCGNATLIYATQSGYKEIVKTLIKLNINLENYIKDNDSETEILIKKETLTMARTVLL
KCYDELSLSPEIFYEWDQLSL
Download sequence
Identical sequences V6DJL3
gi|563707586|ref|YP_008872190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]