SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54297877|ref|YP_124246.1| from Legionella pneumophila str. Paris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54297877|ref|YP_124246.1|
Domain Number 1 Region: 198-352
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 4.05e-76
Family RalF, C-terminal domain 0.0000000805
Further Details:      
 
Domain Number 2 Region: 4-194
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-59
Family Sec7 domain 0.00000000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54297877|ref|YP_124246.1|
Sequence length 398
Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella pneumophila str. Paris]
Sequence
MHPEIEKAQREITEAFNAKPKNGIEKIKEICEEYKISPNEEIAAFFHQQRKNLDLEAVGD
YLSGPEAENQQVLKAFTSQMDFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSGAYSQ
QNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTMDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELNSTTLNKDSTFKKLDSFLHSTDVNINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNILSKWLFGEQPKVIIQPGQ
TKESIDLAAKVAAGFSSPVKNFKATYDYEVGDLIKAYDNQKKLISTNKNTLFKGSMFRKP
NAEQQETSKSATRTLNTDYDINEDTVTRKDESRSSYKK
Download sequence
Identical sequences A0A1S0VG22
297246.lpp1932 WP_011214205.1.100609 WP_011214205.1.101326 WP_011214205.1.1173 WP_011214205.1.15769 WP_011214205.1.17809 WP_011214205.1.19781 WP_011214205.1.21849 WP_011214205.1.28040 WP_011214205.1.30351 WP_011214205.1.3122 WP_011214205.1.3258 WP_011214205.1.35807 WP_011214205.1.36016 WP_011214205.1.37161 WP_011214205.1.39582 WP_011214205.1.41396 WP_011214205.1.41414 WP_011214205.1.44947 WP_011214205.1.45039 WP_011214205.1.46375 WP_011214205.1.46948 WP_011214205.1.48987 WP_011214205.1.49562 WP_011214205.1.50379 WP_011214205.1.53443 WP_011214205.1.54450 WP_011214205.1.5553 WP_011214205.1.58425 WP_011214205.1.5861 WP_011214205.1.58655 WP_011214205.1.59183 WP_011214205.1.61482 WP_011214205.1.63249 WP_011214205.1.63357 WP_011214205.1.64714 WP_011214205.1.65356 WP_011214205.1.65604 WP_011214205.1.6601 WP_011214205.1.67348 WP_011214205.1.69880 WP_011214205.1.72557 WP_011214205.1.728 WP_011214205.1.73276 WP_011214205.1.73409 WP_011214205.1.74197 WP_011214205.1.75016 WP_011214205.1.75926 WP_011214205.1.79423 WP_011214205.1.79768 WP_011214205.1.80208 WP_011214205.1.81040 WP_011214205.1.81849 WP_011214205.1.82883 WP_011214205.1.83690 WP_011214205.1.84032 WP_011214205.1.89129 WP_011214205.1.91040 WP_011214205.1.94262 WP_011214205.1.95686 WP_011214205.1.96370 WP_011214205.1.97870 WP_011214205.1.97946 gi|54297877|ref|YP_124246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]