SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404487885|ref|YP_006711991.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404487885|ref|YP_006711991.1|
Domain Number 1 Region: 811-1032
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.96e-32
Family Multidrug efflux transporter AcrB transmembrane domain 0.005
Further Details:      
 
Domain Number 2 Region: 152-338
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.66e-31
Family Multidrug efflux transporter AcrB transmembrane domain 0.006
Further Details:      
 
Domain Number 3 Region: 465-591
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000091
Family FCH domain 0.054
Further Details:      
 
Domain Number 4 Region: 515-744
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000752
Family Tropomyosin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404487885|ref|YP_006711991.1|
Sequence length 1039
Comment membrane protein YdgH [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MRTIIKARWIIAALWIAMAAVLFITAPDMGQLTKEKGQIAVPEGYPSSYANKLLEQMSKD
GDTNKSVVVVFQDKHLLPNREAALKKAITTLEKDSSLHVSDITSYFNADEDIQKQLLSKD
RTTLLVPVTFDANKISAAEFKAKVNEKLKTLKLDYEMTGQPLIDDDVMTSSQEGLKKTEY
ITVGFILIVLILVFRSAVAPFVPLLAVALSYLVSQSVVAYLVKYADFPLSTFTQIFMVAI
MFGIGTDYCILLLSRFKEEIARGKDKIEAILTTYKTAGRTVLFSGIAVLIGFTCIGFAEF
QLYKSAVAVAVGVAVLILALLSIVPFFMAVLGKVLFWPVRGNIGHPQSKLWETAGRFAFS
KPLISLLIVAAVAVPPILMYKGTLSYNSLDEIGDQYESVSAFNTISDKFGPGESLPVTVV
LKTSDALDTNDGLIAIEKISRAIEQTNGVSKVRSATRPVGKGLSDLYVKTQANELNKGLE
SGNKGLKKIKDGLAEASKSIADQKPQIEASGKGINQLIKGTESIQAGISDVEANMRKLKE
GTDQSKQGVAQAKKEIQTAKKQLTAQVDQLNGQIETYKEISKILKAALSQAENAQGITAD
VQKMIEQTNQNFKNLESEIPEVKENPSYLAIKGSYTELASAIKQGSQKAAVYTKQAANAK
KQLEAADAFIAKAQEEQKVYTSKIDALINGLGQIEKGLEETSKGQGQLADSLPKLESGAG
EVAEGQKQMKEKVGEFAGQLDQLTKGLNSSVDGLEKISSGLMGAGDYLDQLKNASDQEMS
GWFVPKEVLKNKQFQQVFNSYMSDDRHITTIDVILEDNPYGNGAIAKVKDIEASVKRALP
DTHLHDASFGVGGVSSINADLKQLSDQDFSNTVIYMMIGIFLILVLLFRSIVMPVYLVGS
LVLTYFASIGVTEFIFTAFFGYPGLNWAVPFFGFVILMALGVDYSIFLMERFNEYRGTDI
MTAMTESMKNMGSVIISAAVILAGTFAAMLPSGVLSLLQIATLVLTGLLLYAFVMLPLFV
PVMVRIFGSANWFPFKRKE
Download sequence
Identical sequences Q65N44
WP_011197571.1.1290 WP_011197571.1.74244 gi|52079012|ref|YP_077803.1| 279010.BL02211 gi|404487885|ref|YP_006711991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]