SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404488737|ref|YP_006712843.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|404488737|ref|YP_006712843.1|
Domain Number - Region: 6-47
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000349
Family Homeodomain 0.066
Further Details:      
 
Domain Number - Region: 138-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family FCH domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404488737|ref|YP_006712843.1|
Sequence length 235
Comment phage terminase small subunit YqaS [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MAEKHIQAQKDYVKGMKYKDLAEKYGVSVNTIKSWKQRHGWKRKKGAPIEKGVHTKKPGA
PKGNINALGNNGGAPKGNQNAKIHGFYSKFLPEETLEIMEEIQERSPADMIWDQIQIQYA
AIIRAQRIMFVQDKDDMAKELKKTKESDLSSEEEFEIQFAWDRHATFLNAQSRAMGELRS
LIKQFDALAHEEDERRLKLDQMRLNIDKTKAEIERLNDDENDSTFEIIIKDKGER
Download sequence
Identical sequences A0A2J5ZZM6 Q65KQ0
WP_011197866.1.1290 WP_011197866.1.31877 WP_011197866.1.7403 WP_011197866.1.74244 gi|404488737|ref|YP_006712843.1| 279010.BL00985 gi|52079855|ref|YP_078646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]