SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404489496|ref|YP_006713602.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404489496|ref|YP_006713602.1|
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily Homeodomain-like 1.59e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404489496|ref|YP_006713602.1|
Sequence length 201
Comment transcriptional regulator [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MTEQKKDRRVKRTKKMIRDALSELMKNKAFEEISVTDITKKADINRGTFYLHYEDKYDLL
DQSEEEIIQEINKIAKRSIHSMDVLNQDVIDHPLTFVVDIFQYIKENEVFMKAVLGPKGP
GSFRLKFKSVLISNLKRLKTAIRTDPIVPEDYLISYITGAHISVMQQWLENGMKETPHDM
ALILSKITGMGPAYAAGLRKK
Download sequence
Identical sequences A0A1Y0XJB1 Q65IJ1 T5HS95
gi|404489496|ref|YP_006713602.1| gi|52080612|ref|YP_079403.1| 279010.BL01877 WP_003182658.1.12567 WP_003182658.1.1290 WP_003182658.1.20727 WP_003182658.1.21456 WP_003182658.1.22930 WP_003182658.1.27603 WP_003182658.1.30581 WP_003182658.1.31090 WP_003182658.1.34863 WP_003182658.1.34956 WP_003182658.1.35726 WP_003182658.1.35764 WP_003182658.1.42641 WP_003182658.1.50447 WP_003182658.1.54544 WP_003182658.1.55910 WP_003182658.1.57471 WP_003182658.1.62441 WP_003182658.1.62618 WP_003182658.1.71919 WP_003182658.1.7403 WP_003182658.1.74244 WP_003182658.1.8120 WP_003182658.1.85389 WP_003182658.1.86759 WP_003182658.1.94809 WP_003182658.1.9500 WP_003182658.1.95031 WP_003182658.1.96953 WP_003182658.1.98374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]