SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404487628|ref|YP_006711734.1| from Bacillus licheniformis DSM 13 = ATCC 14580

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404487628|ref|YP_006711734.1|
Domain Number 1 Region: 29-135
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000017
Family Collagen-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404487628|ref|YP_006711734.1|
Sequence length 275
Comment hypothetical protein BLi00302 [Bacillus licheniformis DSM 13 = ATCC 14580]
Sequence
MKKSLFLFVFSLFLMAIPAFSASANVYEDEYEPNNSFAEAYDVGLWKYKTISATIHSESD
KDYYKFYATKGEQLAIHLKNIPANTDYDLYLFKDAYGYPAVGSSERMGNQNEIIRLDVPE
TGRYIAVVMSKDGSYDGWGFYRLEFIDRMKSGAYTANLSPSSISSPGQGVVSPVAAVNLA
NASAIPEGATVKSVSAEGTIYPSLGHTYREVLNKEEGVWHTSVSGGTLFPDLKPELALPV
KTTWNVRYYSLAWSSSTWRSPQLKINYQYDSTYGW
Download sequence
Identical sequences A0A1Y0YIV6 Q65NV3 T5HHI8
gi|404487628|ref|YP_006711734.1| 279010.BL01663 gi|52078755|ref|YP_077546.1| WP_003178619.1.10695 WP_003178619.1.12567 WP_003178619.1.1290 WP_003178619.1.20727 WP_003178619.1.21456 WP_003178619.1.22930 WP_003178619.1.27377 WP_003178619.1.27603 WP_003178619.1.27836 WP_003178619.1.30581 WP_003178619.1.31090 WP_003178619.1.31877 WP_003178619.1.34504 WP_003178619.1.34863 WP_003178619.1.34956 WP_003178619.1.35726 WP_003178619.1.35764 WP_003178619.1.42641 WP_003178619.1.46361 WP_003178619.1.46635 WP_003178619.1.47006 WP_003178619.1.48016 WP_003178619.1.50447 WP_003178619.1.54544 WP_003178619.1.55910 WP_003178619.1.57471 WP_003178619.1.62441 WP_003178619.1.64701 WP_003178619.1.70162 WP_003178619.1.719 WP_003178619.1.71919 WP_003178619.1.7403 WP_003178619.1.74244 WP_003178619.1.8120 WP_003178619.1.85389 WP_003178619.1.86740 WP_003178619.1.86759 WP_003178619.1.94809 WP_003178619.1.9500 WP_003178619.1.95031 WP_003178619.1.9558 WP_003178619.1.96953 WP_003178619.1.98374 WP_003178619.1.99505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]