SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54294684|ref|YP_127099.1| from Legionella pneumophila str. Lens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54294684|ref|YP_127099.1|
Domain Number 1 Region: 13-55,90-215
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000942
Family BCR-homology GTPase activation domain (BH-domain) 0.021
Further Details:      
 
Weak hits

Sequence:  gi|54294684|ref|YP_127099.1|
Domain Number - Region: 258-330
Classification Level Classification E-value
Superfamily Prefoldin 0.00863
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|54294684|ref|YP_127099.1|
Sequence length 398
Comment hypothetical protein lpl1761 [Legionella pneumophila str. Lens]
Sequence
MPPAYSTHVIVNVFRCVAQLVSQNPELLNWPGVFRLAGSREESEKLLEQVINDNFSVGSL
ACYILEDGQINNLLLNNVLGMLPLVLKESVLLKAEDPLLKLFMTELKNLLGSEKNNVENT
DPIVQLLSKFIDSLLLSKILDHQRVGEILYHYCYLMHTAGVFHETNLMTWENLAIIMAPH
FTNEFGLYSAEDLLGLIQFTNQLKPILECFIAHPDSGIPFKERHADKLEHLVNTRHTIIE
KLTHMGSESRRIVVAPMKSLMMQASMLRAQIDAVETQLKDSSFKKKDKKELNRQLEKLTE
ELEKLNIEISESTSKIKKMNHGHAKLKEEIRAISRSEDAVSTHAIQQSGASSSSSNSVRI
QLGIFGINSSSSAYLIEEQEEGEVTENEYSGLDSAKLT
Download sequence
Identical sequences Q5WVQ4
297245.lpl1761 WP_011215770.1.40024 WP_011215770.1.62869 WP_011215770.1.85655 WP_011215770.1.85818 WP_011215770.1.90773 gi|54294684|ref|YP_127099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]