SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ06_V3.0980 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ06_V3.0980
Domain Number 1 Region: 305-669
Classification Level Classification E-value
Superfamily SIS domain 6.58e-93
Family double-SIS domain 0.000000979
Further Details:      
 
Domain Number 2 Region: 2-280
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.15e-47
Family Class II glutamine amidotransferases 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ06_V3.0980
Sequence length 670
Comment | organism=Leishmania_infantum | product=glucosamine-fructose-6-phosphate aminotransferase, putative | location=Lin.chr6_V3:411206-413218(+) | length=670
Sequence
MCGILGYANSNVPRTVEQILDILLCCIQKVEYRGYDSAGLAIDANIGSGKEDGTAASAPT
PRPCVVRSVGNINQLREKVFSEAVAATLPPMDATTSHHVGIVHTRWATHGGVCERNCHPQ
QSNNGEFTIVHNGIVTNYSALKELLKGEGYVFYSDTDTEVISVLSEYLYTRKGVHNFADL
LLELSNMVEGSYALLVKSVYFPGQVAASRQGSPLMVGIRHTDNRGSVMKLQTYDFTDPSG
PLEVFFSSDPNAFAEYTRDVVYLEDNDIVHYCDGALRFYNAAERQRSIIKREVQHLETKL
ESLSKGNYAHFMLKEIYDQAESVISSMHGRIDFSSGTVQLGGFTQQSIRAILTSRRILFI
ACGSSLNSCIAVRPLFEELVPLPISVENASDFIDRRPQMQRNDTCFFISQSGETADTLMA
LKLCSEAGAMCIGITNVVESSISRLTHCGIHLKAGVEVGVASTKAYTSQVIVMTLVALLL
SSDSVWLQERRNEILRGLSEVSAKIAEVLRITHDPVKALAARLKESHSVIVLGRGYDLAT
AMEAALKVKELSYVHAEGIHSGELKHGPLALIDETVPVLAMCTNDKHFGLSKAAVQQVNA
RNGAVVVFATGVDAELKAAASEIVLVPKTVDCLQCVINVIPFQLLAYYMALLRGNNVDCP
RNLAKSVTVQ
Download sequence
Identical sequences A4HSY7
XP_001463178.1.40037 psu|LinJ06_V3.0980 gi|146071703|ref|XP_001463178.1| 5671.LinJ06.0980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]