SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ12_V3.0490 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ12_V3.0490
Domain Number 1 Region: 51-601
Classification Level Classification E-value
Superfamily SIS domain 3.21e-215
Family Phosphoglucose isomerase, PGI 0.00000000000000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ12_V3.0490
Sequence length 605
Comment | organism=Leishmania_infantum | product=glucose-6-phosphate isomerase | location=Lin.chr12_v4:298793-300610(+) | length=605
Sequence
MSDYLSKLKEHVLESTEVNGCTPSMATSTFNAPYEVARRTKVLGATDSSLLSLPAWKRLQ
SLYEKHGNESILSHFENDHQRFGRYSIEVGLHSEENFLFLDYSKSHINDEIKDALVALAE
ERGVRAFAKAMFDGQRVNSTENRAVLHVALRNRSNRPIIVDGKDVMTDVNNVLAQMKDFT
EKVRSGEWKGQTGKSISNIVNIGIGGSDLGPVMVTEALKPFSKRDMHCFFVSNVDGTHMA
EVLKQVNLEETIFIIASKTFTTQETLTNAMSARNALMDYLKANNISTDGAVAKHFVALST
NTEKVREFGIDTVNMFVFWDWVGGRYSVWSAIGLSVMLSIGYDNFVEFLTGAHVMDNHFA
SAPTEQNLPMMLALVGIWYNNFFGAETEAVLPYDQYLWRLPAYLQQLDMESNGKGVTKKS
GAVAVQTGPIIFGEAGTNGQHAFYQLIHQGTKIIPCDFIGCVQTQNRVGDHHRILMSNFF
AQTEALMVGKSAEEVRQELAKSGMSDEAIQSMIPHKTFTGNRPSNSILVNALTPRALGAI
IAMYEHKVLVQGAIWGINSYDQWGVELGKVLAKSILPQLKSGNIVSDHDGSTNGLINMFN
TRAHL
Download sequence
Identical sequences A0A0R4J9A9 Q3C164 Q3C165
5671.LinJ12.0490 XP_003859166.1.44059 gi|146080298|ref|XP_001463984.1| psu|LinJ12_V3.0490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]