SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ13_V3.1530 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ13_V3.1530
Domain Number 1 Region: 25-154
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-30
Family Ran-binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ13_V3.1530
Sequence length 158
Comment | organism=Leishmania_infantum | product=Ran-binding protein 1, putative | location=Lin.chr13:588697-589173(-) | length=158
Sequence
MSKTDENGNELMEIEEVAVSDGGAARFAAVDVKSGEERFNVIWQDSGKLMRFDEGENQWK
ERGQGTAKVLQRKDNTSKYMFVFRREGVGKLAAQHYLVKGMKVTKHKQGEKILVWSAFKD
FTDDEEGFPENFVMRLSSKEAADKALAEMMGAIEKSSV
Download sequence
Identical sequences A4HVS6 E9BBM6
psu|LinJ13_V3.1530 XP_001464167.1.40037 XP_003859363.1.44059 5671.LinJ13.1420 gi|146081026|ref|XP_001464167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]