SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ31_V3.0710 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ31_V3.0710
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.7e-31
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ31_V3.0710
Sequence length 282
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=LIn.chr31:247803-248651(-) | length=282
Sequence
MGKIEVTVCAARKLHDCQLIGLPDPFVRLVMGDKKYKTQVVKNSLNPEWGETFRFHIPDE
MSTQLRLEVWNKCTYSDDLMGYYTLSLGGLTKGIVKGQWYILEKSKTQAELHVRLLAVDF
GALPKQEELWMVTTDINRDPVKRAIEDGTWRPGQKTAPPQPQQQAYALPAPVPQQQQQNL
GVQCVAVSPQQAPYVPLLPVQYVPLPQAQYTPQPQPVQYVQQQPPQGYYQPRPPLPQPSY
YPPGPPSPLQSGYHQQPPVPSQQVYYTQLPSQCYAPQPQYQY
Download sequence
Identical sequences A4I6G2
XP_001467331.1.40037 5671.LinJ31.0710 gi|146094614|ref|XP_001467331.1| psu|LinJ31_V3.0710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]