SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ31_V3.0810 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ31_V3.0810
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.46e-25
Family Synaptotagmin-like (S variant) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ31_V3.0810
Sequence length 245
Comment | organism=Leishmania_infantum | product=c2 domain protein, putative | location=LIn.chr31:288836-289573(-) | length=245
Sequence
MGRLEVCICGARNIGDTRKAGAPDPYVKVVMGDRKKTQSKYKTKVASSSLHPVWNEVVKF
QVADYDSEQIVFELWNNNVIVDDLMGAYALSLNGLTRGVVSDLWVILKGTGLSSAELHLQ
ALAVDFGVDPQPSSMVVRSIEEYNAAAATKHAMNTTELKQVACADDLDCVQKPSSSEPAI
GIPLQAQVALPPKPQSQPFYTQQPTYAQQAQPPPHPIYYQQAPLQGSYYGAPPQPPQCMY
GPSPI
Download sequence
Identical sequences A4I6H2
gi|146094648|ref|XP_001467341.1| psu|LinJ31_V3.0810 XP_001467341.1.40037 5671.LinJ31.0810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]