SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ33_V3.1680 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  psu|LinJ33_V3.1680
Domain Number - Region: 174-258
Classification Level Classification E-value
Superfamily SIS domain 0.00146
Family mono-SIS domain 0.055
Further Details:      
 
Domain Number - Region: 86-142
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.0275
Family Pyruvate kinase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ33_V3.1680
Sequence length 326
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=Lin.chr33:646766-647746(+) | length=326
Sequence
MIAIAATPTLSNGAGMAVQRLRVLLPGERRGEVRLLTFKKSVLTAASFEEATHDGYAHRL
GSPYRQGYGDTHRLVDKVLHQAPLRAVAITEDGKSGVTMSEQGMRIRVLDFVGDDKMTNR
LTLDRGHLPAVVDTVSLAIVAVPQAHPLLRNAAAATAYTHERCGSNDNNAPAHASEALSR
QYQRLTEAVHDIVVCLTSSGTIHIFGCGLQQVLFYHSDKTLLPRVGYPYAFSVCLPPLLA
KEGVASVFVARSDVTTSAVHYLPRHEHYVTKGRKRDGSNGATNHLPGEFFAFEMRYHSST
AAAAAAGGAGSTSKCTTLFCFTLSAP
Download sequence
Identical sequences A4I930 E9BQ99
5671.LinJ33.1680 psu|LinJ33_V3.1680 XP_001468249.1.40037 XP_003863994.1.44059 gi|146097887|ref|XP_001468249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]