SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ35_V3.0040 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ35_V3.0040
Domain Number 1 Region: 295-591
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.06e-95
Family Mammalian PLC 0.00000303
Further Details:      
 
Domain Number 2 Region: 149-284
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000506
Family Polcalcin 0.079
Further Details:      
 
Domain Number 3 Region: 600-722
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000039
Family PLC-like (P variant) 0.039
Further Details:      
 
Weak hits

Sequence:  psu|LinJ35_V3.0040
Domain Number - Region: 94-135
Classification Level Classification E-value
Superfamily PH domain-like 0.0193
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number - Region: 26-126
Classification Level Classification E-value
Superfamily PH domain-like 0.0325
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ35_V3.0040
Sequence length 729
Comment | organism=Leishmania_infantum | product=phosphatidylinositol-specific phospholipase-like protein | location=Lin.chr35:9594-11783(-) | length=729
Sequence
MSLTLTGENSWDSSVGRECSELADELKEKGVPLLRVTRNYNVKKVLISFSPVGDGLQCQP
ASEHHSSLLFADMWAIRSLPPSDKICSKAGLTHFQYCFQVESQFGWSWNLVCNTALERST
WVDFLEQRRRTFLDKSRANAANASVERYWFIAAQQGKTKLSFNEISMLANKLFGRVPPAE
FADRFRQCDSDKDTCLNYQEFCEFFHYFNEAKAVRSIYERQTSDGTPGMTAEEFTRFCIA
NDAVANVTPMRCASLFHLFANRQSDRMALNGFTAFLLHPHHNTIVDARQLRLTDSMDHLL
PHYFINSSHNTYLTGNQLNSESSCNMYRDVLLAGCRCVEIDCWDGPAGVPVVYHGRTMTT
KIAFDDVVRTINDYAFQNPSDNHEAAWNPREFPVIVSLEVHTSPEQTNRMAEIIRSVFKE
RLFLSRLDASSYTPAKLKGKILVKWKMNAAGVEDLKDTAGSGIRADRRAPLLTTLKLSAC
ASIGTVRSTSWGAEEQPFNVQSYVEGEVARLEACSPVDFARQNTRMLSRIYPAGTRIDSS
NYDPMLMWRLGCQMVALNWQTRDHNFRVNEGFFTHQNGGCGYVLKPMHLRDVGGGCSAIP
FTLALRLICGSHLGTTFDGADVTHVSLRVWVHGEAWSHETIAVPTTIYPEWNERMELQGR
CKETAVLCLCVVAHTRSGTTHDVCTACIPVRVLRTGYHAMPLRHAKSGHTTEVASVLCHL
SFKTPALFS
Download sequence
Identical sequences A4IAQ5
XP_001468824.1.40037 5671.LinJ35.0140 psu|LinJ35_V3.0040 gi|146100279|ref|XP_001468824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]