SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ07_V3.0270 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ07_V3.0270
Domain Number 1 Region: 748-783,811-973
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-40
Family Sec7 domain 0.00012
Further Details:      
 
Domain Number 2 Region: 523-624,1073-1088,1357-1483,1533-1579,1634-1715
Classification Level Classification E-value
Superfamily ARM repeat 0.0000247
Family HEAT repeat 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ07_V3.0270
Sequence length 2225
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=Lin.chr7:98744-105421(+) | length=2225
Sequence
MAHHQPTNVEVENKVAFFVQLNALLTRISSVVSSDALSSAQKAKLSDVRSATEAWLKDVG
VISAPRPFIAAAPPPPPPPTPLRSSVTETPAAAAPLSETVAASKQQDEEQAEAALTQAPE
APAAEQATATTSSAADGPARASASPATPGGSSTATAAVTSTHERADARKLVGLVSYLRLL
FDSDVPERAKLQEFGKSLVRLLMVRCCSTIMASLQHVVHHTYIGTTTAAEEEGDAEAALS
ALFVQLAKEIDVATKALLGCVRLITSSAVLSEAASARFPVQLCVDVVKQTRRAQVYFQSR
VEREEYHLLRTFVTSSDTAAKSAEGSLEDVDAVHDALESVSPERVAAHVLRRVEALRRRW
GPSLVHSVRNIGDVIEPSVKFLATVAAVRAEVAPAPLVALKKDAAHDLFSLCEPVTVATT
AAGGQPCLAKSLSTCDSPSVVAAPVSASSATPLAWRAAAGEVLIRLGSSFSADYLAAVAA
CCGDSNEGELLATRLLTDMLKCVAAHDLPLLRCVLLDGRWYRALYGGILNCVSSSQPAVL
AAGLDALGLLTTACPVVIGREVGLLYSNVVLRLLESSNTPQYVKRTIVLHFVTTFMGSGS
TLPADGGGGAIPLILHLYRLYDLNVHAHQLNIMQQLTSALSRIVRAAPKEELMQDAVVRE
QLQIQQEAAPSAVMTAPAAQLDGAQHRAEVANGTTSSEPSSLVAAALNPASLSLPAMALH
GLVRIVELLTTQTPPEEESGKDVLASLPAMTCRESKLKEQQEVDRFNAAPKKAIYKLFNV
TAEENAIPASHADFSSQWEHTLLPPLTSAAAAKVEAVADFLNQVSSLNPEAVSEFLTTPE
VFPLQVCRTYLRRLPLAGFSVLEAISELLMRVQLPKEGQRIERLLEYFSAAYYEANRGHG
IDSDIFPFKSDTAVFIVVVATVMLNTNIHNPSAGMRLDVKAFRGQLRRCNDDESFADSFV
DDIFDRISTHPLESIKSVAADANASTDSTSRGPFDMFFVSQEEKRQLAFGVERQRMVSET
RQLLKLRTQQEPLAPAPEGWWCAVAKDFFLSTWSSVCAVFGPAMYEGTTAAPSDVLLQCV
RGLQSLLCMAAAFDLPTECTVTLLTLLRMADATPVREHCRRAVLVVAATTYAVNFPVRCW
VAVCQIILEVRRTAAAATPPLVEDVFTRIEGITRLSVETEERRAADDSAPKTDRPTEAIH
RAMEGVMTTISGYAVGDVANLSSALAVLRRALEYTRIVHANRRTDIVYFVNVRDFTAVVA
PAYVELMKKHSSSDDGLQVLFECLVDLLCTMWVSYSTSRVMVPAPAAAAAGKAETAETPT
VDTAPAEFVQSFRFLRSVYDVTLASASEGAATLLQMHTLQAIKEVLSRTVRTAEMTAAGQ
HLSLYTMMASWQEVLYPLAVALCDRNSTAVEAGSLALLVLRKLVALCGGTGTASSDRLPG
PVRAALLWLLAQLAYMGGMCGDADSAQVCVALLSSICTTTVAMSVTAASSSSPGCSTAGP
ASPVTAVADPSTAARLMEQRNALTQQVVTSIEENPHYVVQCTLARLCLLLQCEREQTRAE
VMHQLRTLSLQMRPAQLCPMALDLAEVVLEGTIGHAAHHRQAPRTQSSLIPFLFFQMPVP
ASMRRCSRTSFRATVPAALGFLANELLTGLSGDDLAMAAESVMRRCLLPILLSPNSPHQC
RFIAVRSLSQCVSVCLPQNSAARSPQLAQCVLDCLAMALYAVRVPLTSVVSPDTSFVGRR
WLDAPAISSASGWAAYCAQATHTVELMDRAEPQWLVRGAAAAAAQVALSTLAATATEERD
GAAATPTSSRGGCATSEETHRADGAAFVPDEALIEYVNLLAQMLAGVPKELQGVVASAAA
AAGSATPSAGAVAVPDMNTDDWKLPRASVTVLLQLCLQAGGTLFAVLWRVNHPHEVEQYA
MQSVESRREALAFTRNSGLLPHAAIRSVLQCYLKLAVLSTEYPSAELLEVTTDIIEGIRQ
VQAATHAAAPSPSPPSLAVGGGAGAVTAGASSTSLAADGASLQRLPPQEQQHVRTCNSGM
YQQLSVVLGYLVRLLTGQSTSMASVAGWARRQEAFEAMALHPQFFSSLVSLLTPTAGMLI
ITVRDYFAWYIAHAQLPHQASEIAGPVTVSGGAACSGEATSTWAAESDEEGPSSSQLTAL
NGTHDGKGSAFGSYSVNGGGSVKLSYVKAARTLSPKPSTVGMERMCMTEVVSDVAAKSTR
NFNSE
Download sequence
Identical sequences A4HT57
5671.LinJ07.0370 psu|LinJ07_V3.0270 gi|146077339|ref|XP_001463248.1| XP_001463248.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]