SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ30_V3.2970 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ30_V3.2970
Domain Number 1 Region: 299-595
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.96e-107
Family Mammalian PLC 0.00000218
Further Details:      
 
Domain Number 2 Region: 604-729
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-23
Family PLC-like (P variant) 0.019
Further Details:      
 
Domain Number 3 Region: 156-282
Classification Level Classification E-value
Superfamily EF-hand 1.28e-22
Family Calmodulin-like 0.061
Further Details:      
 
Weak hits

Sequence:  psu|LinJ30_V3.2970
Domain Number - Region: 24-131
Classification Level Classification E-value
Superfamily PH domain-like 0.0102
Family Pleckstrin-homology domain (PH domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ30_V3.2970
Sequence length 737
Comment | organism=Leishmania_infantum | product=phospholipase c-like protein | location=Lin.chr30:1074265-1076478(-) | length=737
Sequence
MPALTIGSTLPDPPQTSEELLAVQNLLARLQTSLTLRRVTKRNSVRRRTVSLTADGKALE
YKPTRKSRRQLLVFRDLYEVTKMDPASKVYKKAKLNSNTNVVVEMNTRIHRGWRIVFDDK
ASANTWLQMIGYKVKGGALAPSGAVPNEDTLTGCICATWERADTNRDGKVDLKEAKKMMV
RMNVEISDDLLADLVRKHDASGDGALDLEEFTTLFIQLTQHEELRPLFASFAAQVDWMTR
AEFDCFLKAQGDVPSDILFNTLKPDKNSRITFTQFVHYLLSPCLNPALDPAHQTGVVDEM
THPLKDYFINSSHNTYLSGDQFQSSSQIEMYRRALLAGCRCVELDCWDGKDNDPVIYHGH
TRTSKIRFVDVIDTIRRHAFTASPFPVILSLEVHTSDEQSMVMADHLRTILGDMLMTAKD
IPNMMYTPESLKGKVLVKWKLPHNDVDDAKEGLAGSDNDSGAARSPSQKAEASSQGALSH
LLRSCVTVGAFKTSDWGRDAEPYYIQSYVETVVKELALSHRDEFIGQTSRMMVRVYPKGT
RIGSSNYNPTTAWSVGAQLVALNYQTWDDDMRLNDGMFSLNKGCGYVLKPDYLRNPSGKA
KATPCTITVTVLSGTQIPKPSLQKKGDIADPYVKLYINKRDRTEVKTSVVRNNGLNPYWM
ETFTLACESKEIDLLTVKVMDEDTTSANDSVCEMVIPVRALRTGYRAVPMKLCKNGASLP
GASILCKFDIVDLPPQS
Download sequence
Identical sequences A4I5X4
XP_001467143.2.40037 psu|LinJ30_V3.2970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]