SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ32_V3.3780 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ32_V3.3780
Domain Number 1 Region: 103-232
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000822
Family Phosphotyrosine-binding domain (PTB) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ32_V3.3780
Sequence length 272
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=Lin.chr32_V3:1429178-1429996(+) | length=272
Sequence
MLAAQEECRLLAAQLEKSRAARAAFTCGPQGRTRAAPATAPAAATSPPSPQRVYSAATVT
VTVKGPSIGSSTSTSPDRAGSPSAAPPSTSPARVVIPTAATHKEGTLLHLVRGSGLFGGG
SRSFVPHYIVVSGSAGISWYASEAEYRQNPSRPLGHADFWIETFNSRGSRFKKAAVCWPL
ILPDDCPEAKDANKTYFAVDYYTPNEAREQVVLAASSPAERDEWVQVLTKYIDLYLAPRA
ESEELQHIPRGAAVPLHRSGVIEGEAPGGNIL
Download sequence
Identical sequences A4I8I2
psu|LinJ32_V3.3780 gi|146097138|ref|XP_001468051.1| 5671.LinJ32.4140 XP_001468051.1.40037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]