SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|LinJ34_V3.2340 from Leishmania infantum JPCM5 2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LinJ34_V3.2340
Domain Number 1 Region: 1000-1156
Classification Level Classification E-value
Superfamily Sec7 domain 1.16e-51
Family Sec7 domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 1221-1301,1345-1356,1384-1451,1612-1756,1862-1977
Classification Level Classification E-value
Superfamily ARM repeat 0.0000127
Family Mo25 protein 0.072
Further Details:      
 
Weak hits

Sequence:  psu|LinJ34_V3.2340
Domain Number - Region: 585-763
Classification Level Classification E-value
Superfamily ARM repeat 0.0768
Family PBS lyase HEAT-like repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LinJ34_V3.2340
Sequence length 2428
Comment | organism=Leishmania_infantum | product=hypothetical protein, conserved | location=Lin.chr34:988063-995349(-) | length=2428
Sequence
MEKGIEEIVDACAHLLAEMKSDTRERTILSAVSKTLKRLAQESRQHQDQLSAQSAPSQGA
NASLPMPSAAAPSCSASALQSSGAKPSPTGGERTEAAAVVSTTSLEATEATQSVAALLSA
PSSSSTSVPTTTTACSPLQRFLCNDEELSKLAYACRMAIMGENGGLARNSVRILTAALEL
AAVVLTSGVLPSELVAPAPTFAVPESTARGAKVFFSKLLGGKKRPSSPSCAGAPDAVSSE
ITSVPADTVGLSQNVRDCLVDAVLAAVDTVQSKESSDRLYFVMIVALKAAAAPRLSRKAS
TNTQPSAFQPLQLSVHDGRLVSVFRALLELCSRSAGVSPILIDEAQKALHAITRALSKYV
EQGVSDGDDRSGAGGCSKEQTTTSHSASSSSTGTPLMPLPTAVTSISAGKPTGPSFVDPP
LERTETDNGETPDKARELTAEKPPSTTSSTIAAAAAPLGVPPVCDRAETTTAAALTAASP
PRRLRGVTDMLLLLELCGHIARLTPLSCISSILSGSGGGLDVGVAAASASEYHRDAPVNC
AGGGGGGDGAAPAAPRRTSGNATEEGASTTSFSAASLNEHILVTALSFLLYSIVNGGPQF
RKSPDIVQLLRQVVVPAAIRTSISADLDIFRLSINVLLSCCLRFGPQMVSETSTVFRHVY
FRVLDSSFTSLEHKLLVLEAFGSYIEEPQLLLGLFLNYDCNTHSQSFFEMMIHYLGALAM
PPAQQVCNSDLFAELKRVLTVRLEYDVPEPLRRKALVSLLQVSDSNIQWIERFECDQEED
GHAGTPSNGAACRDGATADTVPHELAGCSPFVHDLSEDGLRHGRTHALLCGVEVMGSSMS
GVGSNGGLAAAANVDAFLQARRYKDAFKKFLDLFNQKAAPDAAIEYLENSVLILESAGQA
VSATPEPPTTVGAQGSLNDRAGAAAIPTTATGTTNASTSDGLRNDDAEAPSDSNAVSRRT
EQVPGDGDVDAAAASPAPVEAAATPTAAITSDVDDAMLLSARKVAAFLRVKEDYLDKMVL
GDYFAKCFRRPSSRVVFEEWIGLHDFTGKTLDEALRLFLGGFKLLGEAQVVDKTMELFAA
QYCRQNPGIFGSADTAFILSFSICMLNTDAHSPHIKNKMTKEGFLQNNRGIDEGNDIDPS
ILGGIYDRISGEEIVLRPSPKCGTQPSVHASAAAAAGGFAGGRRSSKLTTNLLDSIPLLR
HLSPIAAAITDKVLLPMDAAGNALFNSARRKREEMYQQELRATLKEVMNALQEASTNDAA
HHAMFLTATSIENALPMWEVSVDVVCHIVVLALQQLLEDSEKYVLPQSFSSPSPPGNELE
AGAEYEAVTAYLEDTQSAGYFSTILLGLQNTVRVCCAFGNVSHTEKLLEHMFEMTRLTSV
VVLKAVPSSRVMIKSTIPFTRLQVLSTFFNLFMQCGSSFNARGWQVAYKAMSLVDALANG
IEGMWQRQARRLLDTTPVSKETSLVLPKSPDSAAKSAASLASTGLDASNNNTRSVSSAAM
APEQQQQQRADLWFGALNDVPASIVDRASRDNRKAILWGLRSVPTCHVDLWLDRLFDATQ
YPPRVQLEMTSGLVKVCEMELQYTRTFSLTKLFDFVSICASFLSRLQWRDLWAHASEVFT
LAGCRSSSEIALSSLDGLRLVALTYLMREELLNYSFQKEVLKPFELILMSNQNVACRQKV
MMILSEVIDFRAEHLASGWNVVFSCLSHAAAIPEVAPSAWSICEDVILRHISYVKDCFSD
LIFCLTTFACSGVEESMPLRAISYLVACGHWLQYGLEAPPLEVRTADAVTRWATRYLTVE
QELAASHVLGKPLSRVTLAAEPLTLDALLQKPMTFTSKTKYHLWMSLFEGMVPIVVVHSS
VRVRAHALSSIWALLAQYAGLFDAEVRSSLFNGMVRPMLTTLLTHVPGDADLVSPTMSGG
YESDRFDYRLLVYLALKGMLLACKDHAHLLELACKVLNELVESTNITMRMLRNDYVDEVL
RVCYDFVWAAPSLATMDALDRLPSVPGAPSSKDAVNYAERLYQWIPTEARHDNPFVVGLV
HEIQQAGVVDVVHFKRTAGWVELHQTPAARNTPVQVSLSRLSATSVQLASAIMLQIRSTI
FRCLTHGLLGKLQLLLSTCEADRNVCLEVSGAMRHVLLGVSFYFLVTRDARAVRFLKSVM
ATSHEHGMVGSHDVASHTEPASLTTAAGTDASAGDGALKSRCSSTAAVAASPAFIATSKN
AVLETLLLIPYACVLIEFIAAFDLGEADDNVVRNDLWAYVSQYLEELKRTRLACIELQQT
VQAGVRAELEAAATTTNPSTPAKQVFKEYKGCHFTDIFRSARYPIGARTLYLTAQSDPSI
RQRVFTEWCYLLRIYALKCTAILGASSVVLQACPTRDLIDVLRVIPSAFEEAAVSAYFNS
CWEEMDLHCSMPPEPCVELCARILESRM
Download sequence
Identical sequences A4IA28
XP_001468597.1.40037 psu|LinJ34_V3.2340 gi|146099259|ref|XP_001468597.1| 5671.LinJ34.2130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]