SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16799373|ref|NP_469641.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16799373|ref|NP_469641.1|
Domain Number 1 Region: 27-87,120-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000012
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16799373|ref|NP_469641.1|
Sequence length 208
Comment hypothetical protein lin0296 [Listeria innocua Clip11262]
Sequence
MMADLQDRLARIQAKITALKEKDPDLNLFGSESHAYKLNEPLSNQTLTTFENEHQITLPP
DYRAFLELIGNGGMGPYYGLETLEDGLCSSLDYKDKKYGVQTLSEPFPHTDDWIAPGYKE
GMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPSYGEIWVDDRNNDNGVYP
DFYFGNEERLGFLEWYEVWLDKSIEEFE
Download sequence
Identical sequences H1GA72 Q92F12
272626.lin0296 gi|16799373|ref|NP_469641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]