SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16799700|ref|NP_469968.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16799700|ref|NP_469968.1|
Domain Number 1 Region: 335-564
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.66e-60
Family Glycerophosphoryl diester phosphodiesterase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16799700|ref|NP_469968.1|
Sequence length 583
Comment glycerophosphoryl diester phosphodiesterase [Listeria innocua Clip11262]
Sequence
MKDLKDSLKILYQFKTDYLKVTLLLTILQAFVIGPFIYYFFFFILRVIGVPGITDANLGE
VFSSPVAVIMLLILALLILLFVYYELGFFIMMAIYQLRGESYTVFKIIQRLNVKAKYFLS
YQAIYFLLYFFLLLPIAGLSLPITITENLYLPHFITDELMKTTTGTWLYVIAIAIIFYIS
ARLVFALPYFIEDKSLKISGAIRKSWKFSQKHLFFMLLKWVLIIVVIGFLVSIIATIIML
PLLLVEKITPGIAVVIAGITLTILQVIGFFAAGIFQGIIAQLLVKNAFAIEGQHAPVARN
QFPHKKRFIIVAIIVFIIFSGFNIFTVNATLYEPNTKIIAHRGDTMNAVENTVEAIESAA
KSGADYSEIDIQETKDHQFVVFHDMTLRRLAGSSKRVADMTLKELQQTKVKSGDYSSHIA
SFDEIIKTAKKNKIDLLVEVKLHGGESSDMVERLVTLLKKEKVTDKYLVQSLNQPVIEEI
EKADPSLKTGIILALNIGNLPKTSADFIVLEDFSINKRLLTQAKQNDKMVFVWTVNKEKL
MQMYLRKNVDGIITNYPKKAIELRESFNENDSLRSRIENRLGF
Download sequence
Identical sequences Q92E36
gi|16799700|ref|NP_469968.1| GO.13752 WP_010990521.1.46653 272626.lin0625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]