SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16800008|ref|NP_470276.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16800008|ref|NP_470276.1|
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000262
Family SMI1/KNR4-like 0.014
Further Details:      
 
Weak hits

Sequence:  gi|16800008|ref|NP_470276.1|
Domain Number - Region: 127-223
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.0167
Family Glycerophosphoryl diester phosphodiesterase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16800008|ref|NP_470276.1|
Sequence length 248
Comment hypothetical protein lin0938 [Listeria innocua Clip11262]
Sequence
MTIWVRNGNNAATEQEISAKETELGLFLPAEYKELLLKQNGGLIRKNHFPTNEPTSYGLD
VAEIYYLASLNELLTDIPEQNDVDLAGKQVYFHRDESRYIGFSYADNKSLPSIIYVDFET
LQTLVVAENMAEFLEALYFSPFPVDFAEQFPVKKLDQILASSNVKKTKQLLELLEDYPDK
KWYLETLIRLLQKNEIPYNIVVYQSFENQLLYFRRKLVPELVEKIFAMLKDCDGIDQSAT
TELYKEWE
Download sequence
Identical sequences Q92D80
WP_010990687.1.46653 WP_010990687.1.51650 WP_010990687.1.99521 WP_010990687.1.99921 368055 gi|16800008|ref|NP_470276.1| 272626.lin0938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]