SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16801854|ref|NP_472122.1| from Listeria innocua Clip11262

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16801854|ref|NP_472122.1|
Domain Number 1 Region: 107-268
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.14e-25
Family SMI1/KNR4-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16801854|ref|NP_472122.1|
Sequence length 270
Comment hypothetical protein lin2793 [Listeria innocua Clip11262]
Sequence
MLTTRKALYYLDKGKTKEAIHLLETCWNQKVTAENKRDIFTATVLLSDVLYQSGERFPEI
YQKLMSILEEMQDLEAVDFEREKAKQIFAELDEYFSEVGTFFQGHSLAELWLKFDSENDY
KDVYPTPQRVAAIEAELGYKLPKSYIYLMRHTQNGGIVSTGSVPTTEPSSWSENCVAITG
IMGIGDCGVSTLNGMHNTNFWTEEWGYPDVGLAIADCPSAGHDMVFLDYRNCGKTGEPAV
VHIDQEGDYKILKLADNFEEFILSLYREEY
Download sequence
Identical sequences H1GFW8 Q927J5
272626.lin2793 WP_003772917.1.46653 WP_003772917.1.99521 gi|16801854|ref|NP_472122.1| 368053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]