SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000016 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000016
Domain Number 1 Region: 74-583
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.65e-190
Family Myeloperoxidase-like 0.0000000000000095
Further Details:      
 
Domain Number 2 Region: 33-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000016   Gene: ENSLAFG00000000018   Transcript: ENSLAFT00000000019
Sequence length 600
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:36641504:36680516:-1 gene:ENSLAFG00000000018 transcript:ENSLAFT00000000019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGRSLSLRFPLLLLLLPTPPVLAAASRAPAPVNPCCSYPCQHQGICVRIGLDLYQCDCT
RTGYSGPNCTVPDLWTWLRNALRPSPSFLHFLLTHGRWFWEFVNATFIREMLMRLVLVVR
SNLVPSPPTYNSAHDYISWESFSNLTYYTRILPSVPQDCPTPMGTKGKKQLPDAQLLAHR
FLLRRKFIPDPQGANLMFAFFAQHFTHQFFKTSGKMGPGFTKALSHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLDGDVYPPSVEEAPVLMHYPRNVSPRSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWNDEQLFQTTRLILIGETIKIVIEEYVQQLSGYLLQLK
FDPELLFGVQFQYSNRIAVEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVE
ALVDAFSRQGAGKIGGGQNLDQHVLHVAVEVIKQSRELRLQPFNEYRKRFGMRPYTSFEE
LTGEKEMAAELEELYGDIDAMEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKPSTFGGETGFNIVKTATLKKLVCLNTKTCPYVSFHVPDPSRDDWFTVERPSTEL
Download sequence
Identical sequences G3SKY4
ENSLAFP00000000016 ENSLAFP00000000016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]