SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000058 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000058
Domain Number 1 Region: 189-278
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000258
Family UBX domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000058   Gene: ENSLAFG00000000071   Transcript: ENSLAFT00000000070
Sequence length 281
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:2008210:2009055:-1 gene:ENSLAFG00000000071 transcript:ENSLAFT00000000070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEAPVNIAPPERRSAVGTAADTFIWQPEPLNMHVIRPKSAKGRTRPRLHISQGAEVCS
SHTPSSPPPAIPCESPSTWKPGACTPKSPNQGAPDEIPELLQQVSIGASSSLNKYPVLPS
INRKNLEERAGETVAKTVSSLHLSSIKAHYQEETRTMKTGEDDSRARACPPEEKVTIETK
RQGSSRTGNLEEPSDQEPRLLLAVRSPSGQRFIHHFRPTDDLQTVVAVAEQKNKTTYARC
SIKTMEVPRRSFSDLTKSLQECRIPHKSVLSISQEDGEEWP
Download sequence
Identical sequences G3SL18
ENSLAFP00000000058 XP_003413477.1.64505 ENSLAFP00000000058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]