SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000267 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000267
Domain Number 1 Region: 1034-1245
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-54
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 1719-1958
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000366
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1237-1339
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000271
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000267   Gene: ENSLAFG00000000317   Transcript: ENSLAFT00000000319
Sequence length 2043
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_79:4087330:4146549:-1 gene:ENSLAFG00000000317 transcript:ENSLAFT00000000319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAESRPFPGRFIAASLSKLLERWSGGTRAEEEEVVDTPEVSKLASGPPATPAQPRQLRSL
SPSVRQLSRRFDAPRLNDDSAEARDGGVSPGAVEEAAEVAARGSWPSVTEMRKLFGGPGS
RRPCADSEALGTPSPDGAAWEPQTREPRQPPTPPPRTCFPLAGLRSVRPLPGPGVEGRRR
QQQQERAQRPADGLHSWHSFSLPQAGARYPVSRSRAASSSEEEEEAPPPTTTTTGAQNPA
YHGGHSSGSDEDRDGEGSHRWGGRQGPTPGNARLGRDCSLDRDGLSLGSMDSAGGGRRSP
EPPTSPRAPSEERSREWGTGTPPCTLGPQEGLRPMPDAVGGAFRVAKVSFPAYLASPAGS
RGSSRYSSTETLKDEDLWSSRGLGGWGVYRSPSFGAGEGLLLRSQARTRAKGPVGTMRAL
RDGGLELDKNRQRKSLSNPDIASETLTLLSFLRSDLSELRIRKAGRHPGDPESDPLDGRD
SPTAGGPVGQLGPMPDPVPASPGTRPTLKDLTATLRRAKSFTCSEKPMACRLPRASTLKP
SSSELLLAGSGSEEDPLPLVVQDQYVQEARQVFEKIQRMGAQQDDGSNAPPGSPDWAGDM
TRGQRSQEELSGPESSLTDEGIGADPEPPVSTLCSLGSAGVWRPLSSSSAQTNHHGSGTG
DSLGGWALVSPEAPPTPGTIRRRRKVPPSGPGGTELSNGEAGEAYRSLSDPIPQRHRTAT
SEEPSGFSVDSNLLGSLGPKTGLPVAPAVDEGLTSGHSDWSVGSEGSKGYQDVIQSIVQG
PGALGRVVDDRTAGKAPKKKSLSDPSRRGELAGPGFEGPGGEPIREVELVLPPSSSEPIL
AEERAEPQELSPARGRAQSERALPEAPPAPATAHCGFHLDPKLADILSPRLIRRGSKKRP
ARSSHQELRREEGHQDQTGSLSRARPTSKHVRHASVPATFTPIVMPEPPTSVRPPVAVPE
PMGFPARTHPALQAPSLEDVTKQYMLTLHSGEVPAPGPVDMPCLARLSPPSDEAKPPEAA
RAPHEPAPASKCCSKPQVDMRKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQPENLLCDP
SLVDEIFNQIPELLEHHEQFLEQVRHCVQTWHAQQKVGDLLVQSFSKDVLVNIYSAYIDN
FLNAKDAVRVAKESRPAFLKFLEQNMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHT
PKDHPDYPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEGMEDLQAPLRR
FLRQEMVIEVKAVGGKKDRSLFLFTDLIVCTTLKRKSGSLRRSSMSLYTAASVIDTASKY
KLLWKLPLEDADIIKARPGASQATNRENIQKAISRLDEDLTTLGQMSKLSENIGFPHQSL
DDTLRDLSAAMHRDLSEKQALCYALSFPPTKLELCATRPEGTDSFIFEFPHPDARLGFEQ
AFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQSCLYTHVGPAYSSCPEPTPGGLCNSD
GYVGPGVILLSLRAEPERPCIAVCSARILCIGAVPRPAAALQPRRERPSSLRSPPETAPE
PTGPELDAEVAVDEEAPALAEPGPQPCLHISIAGSGLEMAPGPAEGDPRPELVPFDSDSD
DESSPSPSGTLQSQASRSTISSSFGNEETPSSKEAMAETTSSEEEQEPGFLPLSGSFGPG
GPCSTSPMDGRALRRSSRGSFTRGSLEDLLSVDPEAFQSSVWLGTEDGCVHVYQSSESIR
DRRNSMKLQHAASVTCILYLNNQVFVSLANGELVIYQREAGHFWDPQNFKSVTLGAQGSP
ITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQDSSRSVACMVDSSLGVWVTLKGS
AHVCLYHSDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSA
GVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPLDTGP
EKLPSLEHQDSPRHRGPASARPKMLVISGGDGYEDFRLSSGAGSSSETVGRDDSTNHLLL
WRV
Download sequence
Identical sequences G3SLH5
ENSLAFP00000000267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]