SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000358 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000358
Domain Number 1 Region: 1239-1400
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-76
Family Pleckstrin-homology domain (PH domain) 0.0000000392
Further Details:      
 
Domain Number 2 Region: 1035-1242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-52
Family DBL homology domain (DH-domain) 0.00000000694
Further Details:      
 
Domain Number 3 Region: 458-580
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 839-917
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000706
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000000358
Domain Number - Region: 769-808
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0143
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000358   Gene: ENSLAFG00000000418   Transcript: ENSLAFT00000000419
Sequence length 1590
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:24699482:24847905:1 gene:ENSLAFG00000000418 transcript:ENSLAFT00000000419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVAHEFYGEKHAGLGRKHTSRSLRLSHKTRRSRHASSGKVIHRNSEVSTRSNS
TPSIPQSLAENGLEPFPQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSIAPSVDSSIVLTA
ASVQSMPDSEGSRLYGDDATYLAEGSRRQHPYTSNGPTFMETANFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKECEEARGMEARVSPRQPSTCQRANSLGDLYAQTN
AGVTANGGPRSKLGGYCRNLVSDIPNLANRKMPPAAAEEAAPCSNYNTLPCRKSHCLSEG
AANPQISHSNSMQGRRAKTTQDVNTGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
AGRAFVGSDSGSSSTGDATRQGYENFRRELQMSTTNSESLEEAGSVHSDEQSSGTLSSPG
QSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDG
RSGIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITA
IHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTIL
DQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSS
FHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGAD
SVKKSLEGIFDDTVPDGKREKEVVVPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTVV
RPGDTARDILELICRTHQLDHSAHYLRLKFLIENKMHQYVPKPEEDIYELLYKEIEICPK
VTQNIQIEKSDTVADNYGFSLSSVEEDGVRRLYVNSVKETGLASKNGLKAGDEILEINNC
AAGTLTSSMLKDFLTQPSLGLLVRTCPELDGGTELLESPPHRVDGPQDLSENPLAFLTSN
PGHSLCSELGRSAETAPEETEGPDPESSDETDHSSKSTEQVAAFCRSLHEMSTPDQSPSP
QDSSGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDEL
DVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFKL
YSAFCASHTKVPKVLVKARTDSAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLLK
ELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVAD
LSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLS
IYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPE
SRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSK
SLGRRRRRLARNRFTIDADAVSASSPEREPQQPPGGGDTDRWVEEQFDLAQYEEQDDIKE
TDILSDDDEFCESAKGTSVDRDLREQLQATSISQREGGREALDSHASRMTQLKKQAALSG
INGGLASTGEEVIWVRREDFTPARKLNTEI
Download sequence
Identical sequences G3SLP4
ENSLAFP00000000358 ENSLAFP00000000358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]