SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000986 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000986
Domain Number 1 Region: 30-459
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.98e-74
Family Integrin alpha N-terminal domain 0.00000332
Further Details:      
 
Domain Number 2 Region: 460-561
Classification Level Classification E-value
Superfamily Integrin domains 4.13e-18
Family Integrin domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000986   Gene: ENSLAFG00000001169   Transcript: ENSLAFT00000001169
Sequence length 562
Comment pep:novel supercontig:loxAfr3:scaffold_36:2622289:2727213:-1 gene:ENSLAFG00000001169 transcript:ENSLAFT00000001169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDARAAPHAARSLRALLLALVAAATPAGAYNLDPQRPVRFQGPDGSFFGYAVLEHFHRQH
ALVLVGAPKADSKYSTSVKSPEAQKQPANHHSLTKPGFSLFPPGKNRGTSCGKTCREDRD
DEWMGVSLARQPKADGNVLACAHRWKNIYYETDHILPHGFCYVIPSNLQAKGRTLIPCYE
EYKKKYGEEHGSCQAGIAGFFTERVCAMGVSGGFEVGGTVFLLNCDFVYYFKLNDEAIVN
RRYTYLGYAVTAGHFSHPSTTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKMG
SYFGSSLCAVDLNADGLSDLLVGAPMFSEIRDEGQVTTYINRGNGALEEQVALTGDSAYN
AHFGESIASLGDLDDDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKINP
VLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSILLPGSINITAPQ
CHDGQQPVNCLNVTACFSFHGKHVPGEIGLNYVLTADVSKKEKGQLPRVYFVLLGETMGQ
ITEKLQLAHREETCHHYLAHVK
Download sequence
Identical sequences G3SN35
ENSLAFP00000000986 ENSLAFP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]