SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000995 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000995
Domain Number 1 Region: 117-358
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-70
Family Nuclear receptor ligand-binding domain 0.00000000144
Further Details:      
 
Domain Number 2 Region: 18-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-26
Family Nuclear receptor 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000995   Gene: ENSLAFG00000001180   Transcript: ENSLAFT00000001179
Sequence length 359
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:10780498:10785177:-1 gene:ENSLAFG00000001180 transcript:ENSLAFT00000001179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEATPTPETMVRGDDDPRNCVVCGDRATGYHFHALTCEGCKGFFRRTASKSTGLACSFDG
SCEVSKAQRRHCPACRLQKCLNAGMRKDSTVILSTEALALRRAKQAQRRAERTPVHLSKE
QKKLVQILLGAHTRHIGTVFDQFVRFRPPAHLFIHHQPLPTLAPELPLLRHFADISTFMV
QQVIKFTKDLPLFRSLPMEDQISLLKGAALEICHIALNTTFCLQTQNFLCGPLRYTMEDG
AQVGFQVEFLDSFFRFHGTLRRLQLQEPEYVLMAAMALFSPDRPGVTQREEIDQLQEEMA
LTLQSYIKGQQPMPRNRFLYAKLLGLLAELRSINDAYGYQIQHIQGLFAMMPLLQEICS
Download sequence
Identical sequences G3SN44
ENSLAFP00000000995 ENSLAFP00000000995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]