SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001449 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001449
Domain Number 1 Region: 110-358
Classification Level Classification E-value
Superfamily vWA-like 3.11e-82
Family Integrin A (or I) domain 0.0000000218
Further Details:      
 
Domain Number 2 Region: 354-444
Classification Level Classification E-value
Superfamily Integrin domains 3.56e-29
Family Integrin domains 0.00011
Further Details:      
 
Domain Number 3 Region: 610-694
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.62e-20
Family Integrin beta tail domain 0.0003
Further Details:      
 
Domain Number 4 Region: 3-54
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000157
Family Plexin repeat 0.00066
Further Details:      
 
Domain Number 5 Region: 569-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Integrin beta EGF-like domains 0.0028
Further Details:      
 
Domain Number 6 Region: 526-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001449
Domain Number - Region: 451-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 495-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001449   Gene: ENSLAFG00000001735   Transcript: ENSLAFT00000001735
Sequence length 777
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_25:19523835:19646340:1 gene:ENSLAFG00000001735 transcript:ENSLAFT00000001735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLNICTRGSATSCEECLLIHPQCAWCSGEDFGSPRSVISRCDLRENLIRNSCGGELESPA
SSTHVLRSQPLSSKGSSSAGSDVIQMTPQEVAVNLRPGDKTTFQLQVRQVEDYPVDLYYL
MDLSLSMKDDLDNIRNLGTKLAEEMRKLTSNFRLGFGSFVDKNISPFSYTAPRYQNNPCI
GYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKI
GWRKDALHLLVYTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG
EKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHGDSKNIIQLIINAYNSIRSKVE
LSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTATFDVSVEARSCPGRQVEQRFT
LRPVGFRDTLEVGVAYSCTCGCSARLEPDSTRCSGNGTYVCGLCECNPGYLGTRCECQEG
ENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLC
SGHGECHCGECRCHAGYIGDNCNCSTGISSCQAKDGQICSDRGHCVCGQCQCTEPGAFGE
TCEKCPTCPDACSTKRDCVECLLLHSGKPAGNQTCHNYCKDEVITWVDTIVKDDQEAVLC
FYKTAQDCVMMFTYTELPSGKTNLTVLKEPECGSAPNAMTILLAVVGSILLIGIALLAIW
KLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYNGTVD
Download sequence
Identical sequences G3SP51
ENSLAFP00000001449 ENSLAFP00000001449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]