SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001608 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001608
Domain Number 1 Region: 932-1054
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-26
Family Ankyrin repeat 0.000000224
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-22
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 3 Region: 1061-1121
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-17
Family SH3-domain 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001608   Gene: ENSLAFG00000001919   Transcript: ENSLAFT00000001924
Sequence length 1130
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:50248274:50287837:1 gene:ENSLAFG00000001919 transcript:ENSLAFT00000001924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFQMFLTVYLSNDEQHFSEVPVTPETVCRDVVDLCKEPGESDCHLAEVWCGSERPVAENE
RMFDVLQRFGSQRSEVRFFLRHERPPSRDIVSGPRSQDPSLKRNGVKVPGEHRRKENGVN
SPRMDLTLAELQEMASRQQQQIEAQQQMLATKEQRLKFLKEQDQRQQQQAAEQEKLKRLK
EIAENQEAKLKKVRALKGHVEQKRLSNGKLALVEEIEQMNSLFQQKQRELVLATSKVEEL
TRQLEMLKNGRIDGHQDSQSAVAELDRLYRELQLRNKLNQEQSAKLQRQRECLNKRNSEV
VVMDKRVNELRERLWKKKAALQQKENLPVSSDGSPPQQAGSAPSRVAAVGPYIQSSTMPR
IPSRPELLVKPAVPDGALATQASEGPMKMQTLPNMRAGASSQAKGPKIHPVGLDWSHSNA
DLFQSQGSVSVSKSPGNAPDQADDGDVPLREKEKKVRPFSMFDTVDPPAAPQPFGTLRKN
QSSEDILRDAQVANKNGAKVPPPVPTKPKQINLPHFGQTNQSPSDIKPDGNPQQLSTTVA
PVGNKPKTAAQQQRGLLSTSAPAAGQDQTLPPGSKPESPPAAAVRPFTPQPSKDTLPPPF
RKPQTVAASSIYSMYTQHQAPGKNFQQAVQSALTKTHTRGPHFASVYGKPVIAAAQSPQQ
HPENVYSSSQGKPGSPEPETEPASSVSENHENERFPRPLSPTKLLPFLSHPYRNQSDADL
EALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPPKPASGT
ASSESPVEIPNPYLNVEQEKEVVSLVPETASPEEAGSASTENNDTPAPSPGLDYVSEGAP
DSSPNLQGNLEEPSPEAAHLLDVYLEEYPPYPPPPYPSGEPEGPGEDPGNMRPPEITGQV
SLPPGKRTNLRKSGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDE
GITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAV
FAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPM
REGDCMTIVRREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences G3SPH5
ENSLAFP00000001608 ENSLAFP00000001608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]