SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001617 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001617
Domain Number 1 Region: 11-73
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000301
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001617
Domain Number - Region: 30-76,259-362
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00261
Family WD40-repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001617   Gene: ENSLAFG00000001933   Transcript: ENSLAFT00000001934
Sequence length 428
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:47053018:47073155:1 gene:ENSLAFG00000001933 transcript:ENSLAFT00000001934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKLSMYKNDDSRPWLTCS
CQGMLTCVGVGDVCNKGKNNCLLCHATRRTRWCPATITERFDQRFHRRILIKRGKMQNRI
SNLMVSRLSGATVKDIIPNLCDLTVRLELKPSFSLHPPLSPFSLVQVDSLSVTPGPSGIP
ELMVSQPGCAYAILLCTWNKDPGSPPASEGATEGSREPPAGRDVVLHQTSGRIHNKNVST
HLIGSIKQGHSPESGASGLFALCTLDGTLKLMEEADKLLWSVQVDHQLFALEKLDVTGNG
HEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKEGRNSPCLVYVTFNQKIY
VYWEVQLERMESTNLLKLLETEPEYRRLLQELGVDPDDLPAARALLHQTLYHPDQPQQCA
PSSLQDPT
Download sequence
Identical sequences G3SPI0
ENSLAFP00000001617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]