SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001645 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001645
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-30
Family Ubiquitin-related 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001645   Gene: ENSLAFG00000001967   Transcript: ENSLAFT00000001966
Sequence length 87
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_67:12049184:12055946:-1 gene:ENSLAFG00000001967 transcript:ENSLAFT00000001966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPI
NETDTPAQLEMEDEDTIDVFQQQTGGT
Download sequence
Identical sequences G3SPK1
ENSLAFP00000001645 ENSLAFP00000001645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]