SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001670 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001670
Domain Number 1 Region: 388-605
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-55
Family DBL homology domain (DH-domain) 0.000098
Further Details:      
 
Domain Number 2 Region: 908-1166
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000275
Family WD40-repeat 0.05
Further Details:      
 
Domain Number 3 Region: 622-695,789-834
Classification Level Classification E-value
Superfamily PH domain-like 0.00000157
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001670   Gene: ENSLAFG00000001995   Transcript: ENSLAFT00000001996
Sequence length 1356
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_20:5619366:5747123:-1 gene:ENSLAFG00000001995 transcript:ENSLAFT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSQVDMEDPMPSLENEVKYDTNNNEEEEGEQFDFDSGDEIPEADRQTPSDPTASNAVANE
EASNTEPAAGENGPGTETMVLAEPAKLTVPTKVNPYSVIDITPFQEDQAPAPEPNAEEDG
LSLHVPSGYSIPVPCGYAVPSSLPLILPAYSSPVIIRTVSVDEEAETQEAAEDSQFNSFS
SEDPPNSEDQGNKEDSALARWVADPANTAWMENAEEAIYDDVPRENSDSEPDEMIYDDVE
NGDEGGNSSLEYGWSSSEFESYEEQSDSECKNGTPRSFLRSNHKKQLSHDLTRLKEHYEK
KMKDLMANTVGAVEIQQLKQKHELKMQKLMKAAKEGTKDGLEKTKAAVKRGRSFIRTKSF
ISQDHRSCLEEEQNLFIDVDCKHPEAIMTPMPEGLSQQQVVRRYILGSIVDSEKNYVDAL
KRILEQYEKPLSEMEPKILSERKLKMVFYRVKEILQCHSMFQIALASRVSEWDSLEMIGD
VFVASFSKSMVLDAYSEYVNNFSTAVAILKKTCATKPAFLDFLKQCQESSPDRITLYSLM
MKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQ
IAKAINERYLNKLLSSGNRYLIRSDDMIETVYNDRGEIVKTKERRIFMLNDVLMCATVSA
RTSHESNAMISTSQRYLLKWSVPLGHVEVIEYGNNEGPGENSRYPPVHSLESLLVVANAK
PNKVYTGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQSIAHDWTSGLQRLILK
KEEEIRAADCCRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKQSWINNLQMAKLALDIIT
EEENHMGWFCVEDDGNQIKKDKHPLLVRYMPVMVAKQQEFKIECAAYNPEPYLSNENQPD
SVSMAHGFLWIGSCTNQMGQIAIVSFQNSNPKVIECFNVESRILCMVYIPVEEKRKEPDE
ASDCETGAVRASGVPTICLGTEEGSIFIYKSSQGSKKVRLQHFFTPEKSTVMSLACTSQN
LYAGLVNGTVAIYTKAEDGSWNSEPQKVIKLGVLPVRSLLLMEDTLWAASGGQVFIISIE
THSIENQLEAHQEEGMVISHMAVAGVGIWIAFTSGSTLRLFHTETLKHLQDINIATPVHH
MLPGHQRVSVTSLLVCHGLLMVGTNLGIVVALPVPRLQGIPKVTGRGMVSYHAHNGPVKF
LVTATALHKKNKNKSRDSLPPSSEPQDEDQKDMLPSEALSSCLSHSNPDGAIWLGDPLGS
MTQKSDLSSSSGSLTLSHGSSSLEHKSEDSIIYDLLRDPNISLKSKAQRFKRAKACSVLV
VCGGQGHRRVNKKTRQQRPDELVSSVMVWQIPLLNI
Download sequence
Identical sequences G3SPM0
ENSLAFP00000001670 ENSLAFP00000001670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]