SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001790 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001790
Domain Number 1 Region: 211-483
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-78
Family Nuclear receptor ligand-binding domain 0.00000000161
Further Details:      
 
Domain Number 2 Region: 159-238
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001790
Domain Number - Region: 132-172
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.0119
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001790   Gene: ENSLAFG00000002141   Transcript: ENSLAFT00000002140
Sequence length 489
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_105:2739345:2744698:1 gene:ENSLAFG00000002141 transcript:ENSLAFT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRWRRRRPWLDREQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPHGAPPPSPPGPP
LPPSAAPSLGGTGAPPQPPLPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINS
TVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEG
CKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKD
KDGDGEGAGGAPEEMPVERILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAAD
KQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVH
RNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLR
EKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLME
MLEAPHQLA
Download sequence
Identical sequences G3SPX0
ENSLAFP00000001790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]