SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002009 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002009
Domain Number 1 Region: 493-790
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-85
Family Pancreatic carboxypeptidases 0.00000000154
Further Details:      
 
Domain Number 2 Region: 55-377
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.61e-78
Family Pancreatic carboxypeptidases 0.00000108
Further Details:      
 
Domain Number 3 Region: 918-1206
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.88e-68
Family Pancreatic carboxypeptidases 0.0000127
Further Details:      
 
Domain Number 4 Region: 790-870
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.26e-19
Family Carboxypeptidase regulatory domain 0.0000291
Further Details:      
 
Domain Number 5 Region: 378-456
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.02e-16
Family Carboxypeptidase regulatory domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1207-1305
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000451
Family Carboxypeptidase regulatory domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002009   Gene: ENSLAFG00000002399   Transcript: ENSLAFT00000002399
Sequence length 1373
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:3275007:3338137:1 gene:ENSLAFG00000002399 transcript:ENSLAFT00000002399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRDARPPRRPGSLPLLLCLLLLRTPAQAAHIKKAEATTTTTSAGAQAAEGQFDRYYH
QEELSSVLREVAAAASPGLARLFSIGRSVEGRPLWVLRLTAGLEPPPPDGDAGPDAAGPL
LPGRPQVKLVGNMHGDETVSRQVLVYLARELVAGYRRGDPRLVRLLNTTDVYVMPSLNPD
GFERAREGDCGLGDGEPPGPTGRDNSRGRDLNRSFPDQFRTGEPPALDDVPEVRALIDWI
RRNKFVLSGNLHGGSVVASYPFDDSPEHKVSGIYSKTSDDEVFKYLAKAYASNHPIMKTG
APHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLKQE
WENNRESLITLIEKVHIGVKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHRLLVP
GTYNLTAVLTGYMPLTFNNITVKEGPATEVNFSLRPTVTSVIPDTTEAVAIASTVAIPNI
PPGTPSSHQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISD
NPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVRSTRIHLMPS
MNPDGYEKAQEGDSISVVGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKAYPFV
LSANLHGGSLVVNYPYDDDEQGLATYSKSPDDAVFQQIALSYSKENFQMFQGRPCKNIYP
TEYFPHGITNGANWYNVPGGMQDWNYLHTNCFEVTVELGCVKYPFEKDLPKLWEQNRRSL
IQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITAS
ARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNSESKKGKGDSTNTDGASDPTTKEFETL
IKDLSAENGLEDLILRSSSNLALYRYHSYKDLSEFLRGLVMNYPQITNLTSLGQSAEYRH
IWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLIDR
TRIVIVPSLNPDGRERAQEKDCTSKTGQTNAHGKDLDTDFTNNASQPETKAVIENLIQKQ
DFSLSVALDGGSVLVTYPYDKPVQTVENRETLKHLASLYANNHPSMHMGQPSCPNKSDEN
IPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPTAAQLPSLWAENKKSLLSM
LVEVHKGVHGFVKDKSGKPVSKAVIVLNEGIKVHTKEGGYFHVLLAPGFHNINAIADGYQ
QQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIKS
NRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences G3SQE2
XP_003416848.1.64505 ENSLAFP00000021812 ENSLAFP00000002009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]