SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002014 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002014
Domain Number 1 Region: 416-634
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-51
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 625-755
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000513
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002014   Gene: ENSLAFG00000002406   Transcript: ENSLAFT00000002406
Sequence length 857
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:12361989:12369381:1 gene:ENSLAFG00000002406 transcript:ENSLAFT00000002406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRLRPPSRPRGGAQTPGLPHNGSSPQEPPPTSNDAPTPMCT
PIFWEPPATSLKPRALLPPSASRASLDSPTSPGSSSSTPSPVSQRSISPELVPQSPVPPP
KPSRSPCTPLLLLPAAQALAPDGSTSDGSTSGPGTGTVRRLAGKFEWGAEGRAQAADALE
KGPQSGTDVNREREAPQGILAGSGSQENGAVDAPLACPPGCPCVCHVARPGLELRWVPVR
GCEDGPRVPSRVSPLRTSRSRPNPPNSSHPPVVLTSYRSTAERKLLPPLKPPKPAWVRQD
AAIPGDSPQPDLGLPSEDGTQTGTQHGWDSPDEAPRNDSPATMEGREEEGLEGLKEQNWE
LPLQHEPLYQTYRAAVLSEELWGVGEDGGPFPTNPGEAPTLARPPGPRNTLWQELPAVQA
SGLLETLSPQERRMQESLFEVVTSEASYLRSLQLLTDTFVLSQALRDTLTPRDHHTLFSN
VQRVQGVSERFLGTLLSRVRASPHISDLCDVVHSHAVGPFSVYVDYVRNQQYQEETYSRL
MDTNMRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILHQTEEGSSRQENA
QKALSAVSKIIERCSAEVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTEL
GCRRGGVLFPSRPRFTPLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGP
PTFRLSLLSNHQGRPTHRLLQASSLSDMQRWLGAFPTPGPLPCSPDTIYEDCECSQELCS
EPSTPSKTEGRSLVSRDPPKHLHKSPEGWLKGVPGVFPPQLVCEVTGEHERRKHLRQHQR
LLESVGSSSGPSSAPPP
Download sequence
Identical sequences G3SQE5
ENSLAFP00000002014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]