SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002132 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002132
Domain Number 1 Region: 33-464
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.19e-73
Family Integrin alpha N-terminal domain 0.00000841
Further Details:      
 
Domain Number 2 Region: 762-998
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-42
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 3 Region: 620-753
Classification Level Classification E-value
Superfamily Integrin domains 4.6e-20
Family Integrin domains 0.0025
Further Details:      
 
Domain Number 4 Region: 464-619
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-19
Family Integrin domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002132   Gene: ENSLAFG00000002548   Transcript: ENSLAFT00000002549
Sequence length 1069
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_31:18357181:18385208:-1 gene:ENSLAFG00000002548 transcript:ENSLAFT00000002549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGLRRAPGAPSPVLCALALMVAAGGRVASAFNLDTRFLVVKEARNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTTQKDDCERMSIEEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDRGDDWQTY
HNEMCNSNTGYLETGMCQLGTSGGFTQSTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
DPEDQGNLYIGYTMQVGSAILHPTDITIVTGAPRHQHVGAVFLLSQEAGGDLRRRQVLEG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFDRKEEVGGAIYVFMNQAGNSFPAQPSLL
LHGPSRSAFGFSMASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSRGLLREPQQVIHGE
QLGLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDQIVLLRARPVINILHKTLVARPSVL
DPALCTATSCVQVELCFAYNQSAGNPSYRQNISECWGAEADRGPQAHPRLRFARSQSAVF
KGFSFSMPEMRFQTLELLLMDNVRDKLRPILISMNYSLHLRMPERPRVGMRSLDAYPVLN
QAQALENHTEVHFQKECGPDNKCESNLGMQADFVTEQMQRLRRLQYGRDTRKLLLSINVT
NFPSQIRAGEDAHEALLTVEVPPALLLSSVRPPGACQANESILCELGNPFKRNQRMELLI
AFEVIGVTLHTRELQAQLQLSTSSHQDDLQAITLPLLVDYMLQASLSMVSHRLQSFFGGT
VMGEAGMKTVEDVGSPLKYEFQVGPMGEGLAALGTLVLGLEWPYEVANGKWLLYPTEITV
HGNGSWPCQPPGGLVNPLNLTFSVPGDGPPSPQRRRRRQLDPGRGQGPPPVILAAAKKAK
SETLLTCANGRAHCVWLECPIPDAPVITNVTVQARVWNSTFIEDYKDFDRVRVNGWATLF
LRTSVPTINMENKTIWFSVDIDSDLVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCD
FFQRTRYYQIMPKYHAVRIPEEERYPPPGNTVPTKKHWVTSWQTRDRYY
Download sequence
Identical sequences G3SQP4
ENSLAFP00000002132 ENSLAFP00000002132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]